Primary Polyclonal

Antigen: synthetic peptides corresponding to amino acids 186-199 and 509-523 of human SMAD4 Host: rabbit Cross Reactivity: (+) Human, new world monkey, mouse, and rat SMAD4; predicted to react with chicken, bovine, Drosophila, porcine, pufferfish, ovine, Xenopus SMAD4 Application(s): WB SMAD4 is a...

Immunogen: synthetic peptide from C-terminal region of human optineurin Host: rabbit Species-Reactivity: (+) human optineurin Application(s): WB

Antigen: human HHATL, C-terminal region Host: rabbit Cross Reactivity: (+) human Application: FC, IF, and WB

Antigen: peptide from the C-terminal region of human DAT Host: rabbit Cross Reactivity: human, mouse, and Macaque monkey DAT Application(s): IHC and WB DAT is responsible for the reaccumulation of dopamine after it has been released. DAT antibodies are widely used as markers for dopaminergic and...

Immunogen: Synthetic peptide from the C-terminal region of human TP Host: Rabbit Species Reactivity: (+) Human, African green monkey, mouse, and rat TP receptor Application(s): FC The TP receptor is a GPCR that mediates the action of TXA2.

Immunogen: Synthetic peptide from the N-terminal region of mouse protein LPA3 Host: Rabbit  Species Reactivity: (+) Human, mouse, and rat LPA3 Application(s): ICC and WB LPA3 is a GPCR that mediates many cellular responses including cytoskeletal rearrangements, cell proliferation, and...

Immunogen: peptide from an internal region of ovine COX-1 Host: rabbit Cross reactivity: (-) ovine, human, and mouse COX-2 Species reactivity: (+) ovine seminal vesicle, human, bovine endothelial, and porcine COX-1 Applications: WB, ICC, IHC

Antigen: human SOAT-2/ACAT-2 amino acids 3-20 Host: rabbit Cross Reactivity: (+) human, mouse, ovine, porcine, and rat SOAT-2/ACAT-2 Application(s): ICC, IHC, and WB SOAT-2/ACAT-2 catalyzes the formation of cholesterol esters from cholesterol and long chain fatty acyl-CoA.

Antigen: human VE-cadherin amino acids 259-434 Host: rabbit Cross Reactivity: (+) human, bovine, and mouse VE-cadherin Application(s): WB, ICC, and IP

Immunogen: Peptide from the C-terminal region of rat RSK2 Host: rabbit Species Reactivity: (+) rat RSK2 Application(s): WB RSKs 1-4 are downstream members of the ERK/MAPK cascade. Recent work suggests that RSK2 exerts a tonic regulation on G protein-coupled signaling.

Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.

Antigen: synthetic peptides corresponding to amino acids 85-99 and amino acids 372-388 of human SMAD6 Cross Reactivity: (+) Human, new world monkey, mouse, rat, and ovine SMAD6; predicted to react with horse SMAD6 Application(s): IHC, WB SMAD6 is an inhibitory SMAD (I-SMAD) that is part of a family...

Peptide Sequence: human 15-LO-2 amino acids 163-181 (CLDEKTVEDLELNIKYSTA) To be used in conjunction with Cayman’s 15-LO-2 polyclonal antibody (Catalog No. 10004454) to block protein-antibody complex formation during immunochemical analysis of 15-LO-2.

Antigen: peptide from human TLR1 within the region of amino acids 400-450 Host: rabbit Cross Reactivity: (+) human, mouse, and rat TLR1 Application(s): FC (intracellular and cell surface) and WB TLR1 interacts with TLR2 and coexpression of TLR1 and TLR2 enhances the NF-kB activation in response to a...

Antigen: native protein purified from bovine brain Host: rabbit Cross Reactivity: (+) human, rat, and mouse synapsin I Application(s): WB

Antigen: human GPR12 amino acids 2-16 Host: rabbit Cross Reactivity: (+) human GPR12 receptor Application(s): FC and ICC

Antigen: synthetic peptide corresponding to mouse IkBζ amino acids 684-699 and 285-298 Host: rabbit Cross Reactivity: (+) mouse IkBζ Application(s): WB IκBζ preferentially associates with the NF-κB subunit p50 rather than p65 and recombinant IκBζ proteins...

Antigen: synthetic peptide corresponding to amino acids 194-209 of human HDAC4 Host: rabbit Cross Reactivity:(+) human and mouse HDAC4 Application(s): WB, IP, and ChIP HDAC4 is a class II HDAC that can shuttle between the nucleus and cytoplasm, suggesting potential extranuclear functions by...

Antigen: human BLT1 receptor amino acids 331-352 Host: rabbit Cross Reactivity: (+) human, bovine, and mouse BLT1 receptor Application(s): FC, ICC, IHC, and WB The human BLT1 receptor is a GPCR that mediates the proinflammatory effects of leukotriene B4 (LTB4). Northern blotting reveals that the...

Antigen: synthetic peptide corresponding to human histone H4 amino acids 15-30 Host: rabbit Cross-Reactivity: (+) Human histone H4 Application(s): WB Histone H4 is a structural component of the nucleosome and is subject to covalent modification including acetylation and methylation, which may alter...

Antigen: human caspase-3 amino acids 166-183 Host: rabbit Cross Reactivity: (+) human, mouse, baboon, and hamster caspase-3; recognizes both the proform and active subunits of caspase-3 Application(s): WB and IHC Caspase-3 is a key effector caspase in the apoptosis cascade and is efficiently...

Antigen: human, mouse, and rat amino acids 22-36 Host: rabbit Cross Reactivity: (+) human, mouse, rat, ovine, and porcine PPARa; (−) PPARg Application(s): WB PPARa is a ligand-activated transcription factor involved in the regulation of lipid homeostasis.

Antigen: synthetic peptide corresponding to human IRAK-1 amino acids 700-712 Host: rabbit Cross Reactivity: (+) human and mouse IRAK-1; (−) IRAK-2 Application(s): IP and WB IRAK-1 is associated with the IL-1 receptor subunits IL-1RI and IL-1RAcP after IL-1 binding and serves as a signaling...

Peptide Sequence: rat lysoPLD amino acids 573-588 To be used in conjunction with Cayman’s lysoPLD polyclonal antibody (Catalog No. 10005375) to block protein-antibody complex formation during immunochemical analysis of lysoPLD