Chemicals Enzymes and Inhibitors
-
-
-
-
Hyaluronidase from Ovine Testes
MP BiomedicalsHyaluronidase is a glycoprotein containing 5% mannose and 2.17% glucosamine, it catalyzes the random hydrolysis of 1,4-linkages between 2-acetamido- 2-deoxy- β-D-glucose and D-glucose residues in hyaluronate. Hyaluronidase from bovine testes is a tetramer consisting of 4 equal subunits with a…
-
-
ß-Amyloid Peptide 42-1 (Reverse)
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
-
Paclitaxel
MP BiomedicalsAnticancer compound. Chemotherapeutic used in patients with cancer and advanced forms of Kaposi's sarcoma. Microtubule assembly stabilizer. Reversibly binds to polymerized tubulin. Anti-mitotic. Mitotic spindle assembly, chromosome segregation and cell division inhibitor. Induces cell cycle…
-
-
Phosphatase Inhibitor Cocktail Set III
MilliporeSigmaA cocktail of four phosphatase inhibitors for broad-spectrum inhibition of both serine/threonine and protein tyrosine phosphatases. Available as a 1 ml vial or as a set of five 1 ml vials. Each vial contains 1 ml of aqueous solution with the following components: 50 mM Sodium Fluoride, 10 mM…
-
-
ß-Glucuronidase Solution from Patella vulgata
Soltec Bio Sciencebeta Glucuronidase solution from limpets, (Patella vulgata) is more effective and superior for hydrolyzing opoid glucuronides derived from Buprenorphrine (suboxone) and Norbuprenorphrine. The enzyme is an aqueous solution derived from limpets - patella vulgata <7500 units/ml sulfatase…
-
DEPC
Bio Basic Inc.DEPC: Molecular formula: C6H10O5 Formula weight: 162.1 Density: 1.12 g/mL Molarity: 6.9 M Refractive Index: 1.398 at 20oC Diethyl Pyrocarbonate (DEPC) is sensitive to moisture and to pH; it decomposes to ethanol and carbon dioxide in aqueous solution. It decomposes at 155°C. DEPC is also…
-
-
-
-
-
PMSF (Phenylmethylsulfonyl fluoride)
G-BiosciencesFeatures Synonyms: α-Toluenesulfonyl fluoride, Benzylsulfonyl fluoride, Phenylmethylsulfonyl fluoride CAS Number: 329-98-6 Molecular Formula: C₇H₇FOâ‚‚S Molecular Weight: 174.19 g/mol Activity: >99.9% …
-
RPI Trypsin
RPI (Research Products International)The RPI trypsin is suitable for use in research facilities and chemical laboratories to conduct wide range of molecular biology experiments. It is available in sturdy bottle that endures heavy and rigorous usage. Application: For Research or Further Manufacturing use only
-
ArcticZymes R2D Ligase™
ArcticZymesArcticZymes RNA to DNA Ligase (ArcticZymes R2D LigaseTM) is the first ligase on the market that is able to ligate DNA to 5’-phosphorylated ends of RNA in the presence of a DNA template positioning the joinable ends. With its unique substrate specificity, ArcticZymes R2D Ligase allows the…
-
-
Trypsin 0.05%-EDTA 0.1%
Quality BiologicalTrypsin is a proteolytic enzyme used to detach adherent cell from culture vessel surfaces. Typical use includes removing adherent cells from a culture surface. Applications Trypsin is a serine protease derived from porcinepancreas. It is a single chain polypeptide of 223 amino acid residue…
-
-
Trypsin (Porcine), Mass Spectrometry Grade
G-BiosciencesA Chemically Modified, TPCK treated, Affinity Purified Trypsin Trypsin is a serine endopeptidase that specifically cleaves peptide bonds on the carboxy side of s-aminoethyl cysteine, arginine and lysine residues, and typically, there is little to no cleavage at arginyl-proline and lysyl-proline…
-
-
-
-
-
-
Protease from Staphylococcus aureus V8 Strain
MP BiomedicalsProtease from Staphylococcus aureus strain V8 is composed of a single polypeptide chain. The Staphylococcus strain V8 protease specifically cleaves peptide bonds on the carboxyl (COOH) terminal side of aspartic and glutamic acid residues. Protease V8 is used for selective cleavage of proteins…
-
ProteaseArrest™ for Plant
G-BiosciencesA broad range, 100X concentrated, ready-to-use protease inhibitor cocktail. Plant ProteaseArrest™ inhibits plant serine, cysteine and other plant specific proteases including aminopeptidases, aspartic and metalloproteases. ProteaseArrest Family Our ProteaseArrest™ is a…
-
-